Loading...
Statistics
Advertisement

Change Has Inspired New Opportunities | "Behold, I have caused thine ...
www.chinooutreach.org/
"Behold, I have caused thine iniquity to pass from thee, And I will clothe thee with change of raiment." - Zechariah 3:4

Chinooutreach.org

Advertisement
Chinooutreach.org is hosted in United States / San Francisco . Chinooutreach.org uses HTTPS protocol. Number of used technologies: 9. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 6. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Chinooutreach.org

Technology

Number of occurences: 9
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback
  • Shortcodes

Advertisement

Javascripts

Number of occurences: 6
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Chinooutreach.org

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 302046798112104309934761431028409386613512
    • validFrom: 160408153700Z
    • validTo: 160707153700Z
    • validFrom_time_t: 1460129820
    • validTo_time_t: 1467905820
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 44:63:4F:22:F7:7D:3B:B6:FD:CD:4B:83:3F:86:04:9B:95:D0:3D:F9
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:chinesetranslation.live, DNS:chinesischinlandshut.de, DNS:chinetography.com, DNS:chinganadelcerro.cl, DNS:chinglish101.com, DNS:chingshinstudent.com, DNS:chinhle.net, DNS:chinjulie.com, DNS:chinjulie.org, DNS:chinooutreach.org, DNS:chinorbust.com, DNS:chinsblog.com, DNS:chinseisuke.com, DNS:chinsontour.com, DNS:chiomegaunc.com, DNS:chiopaniagua.com, DNS:chip-carter.com, DNS:chipaware.org, DNS:chiphomeprogram.com, DNS:chipmurraymft.com, DNS:chipoftheoldblog.com, DNS:chippewasecurity.com, DNS:chippewavalleyfinancialservice.com, DNS:chipsorsalad.com, DNS:chipthechefseries.com, DNS:tls.automattic.com, DNS:www.chinesetranslation.live, DNS:www.chinesischinlandshut.de, DNS:www.chinetography.com, DNS:www.chinganadelcerro.cl, DNS:www.chinglish101.com, DNS:www.chingshinstudent.com, DNS:www.chinhle.net, DNS:www.chinjulie.com, DNS:www.chinjulie.org, DNS:www.chinooutreach.org, DNS:www.chinorbust.com, DNS:www.chinsblog.com, DNS:www.chinseisuke.com, DNS:www.chinsontour.com, DNS:www.chiomegaunc.com, DNS:www.chiopaniagua.com, DNS:www.chip-carter.com, DNS:www.chipaware.org, DNS:www.chiphomeprogram.com, DNS:www.chipmurraymft.com, DNS:www.chipoftheoldblog.com, DNS:www.chippewasecurity.com, DNS:www.chippewavalleyfinancialservice.com, DNS:www.chipsorsalad.com, DNS:www.chipthechefseries.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Chinooutreach.org

Number of occurences: 10
  • Name:
    Content: en_US
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: application-name
    Content: Change Has Inspired New Opportunities
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: "Behold, I have caused thine iniquity to pass from thee, And I will clothe thee with change of raiment." - Zechariah 3:4
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: Change Has Inspired New Opportunities on WordPress.com
  • Name: description
    Content: "Behold, I have caused thine iniquity to pass from thee, And I will clothe thee with change of raiment." - Zechariah 3:4

Server / Hosting

  • IP: 192.0.78.25
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns1.wordpress.com
  • ns2.wordpress.com
  • ns3.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Sun, 12 Jun 2016 15:14:30 GMT Content-Type: text/html Content-Length: 178 Location: https://chinooutreach.org/ X-ac: 3.fra _dfw X-Cache: MISS from s_hk1 X-Cache-Lookup: MISS from s_hk1:80 Via: 1.1 s_hk1 (squid/3.5.9) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Sun, 12 Jun 2016 15:14:31 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.fra _dfw

DNS

host: chinooutreach.org
  1. class: IN
  2. ttl: 295
  3. type: A
  4. ip: 192.0.78.24
host: chinooutreach.org
  1. class: IN
  2. ttl: 295
  3. type: A
  4. ip: 192.0.78.25
host: chinooutreach.org
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: chinooutreach.org
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: chinooutreach.org
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: chinooutreach.org
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.hinooutreach.org, www.cdhinooutreach.org, www.dhinooutreach.org, www.crhinooutreach.org, www.rhinooutreach.org, www.cthinooutreach.org, www.thinooutreach.org, www.cvhinooutreach.org, www.vhinooutreach.org, www.cfhinooutreach.org, www.fhinooutreach.org, www.cghinooutreach.org, www.ghinooutreach.org, www.chhinooutreach.org, www.hhinooutreach.org, www.cnhinooutreach.org, www.nhinooutreach.org, www.cmhinooutreach.org, www.mhinooutreach.org, www.cjhinooutreach.org, www.jhinooutreach.org, www.cinooutreach.org, www.cheinooutreach.org, www.ceinooutreach.org, www.chdinooutreach.org, www.cdinooutreach.org, www.chcinooutreach.org, www.ccinooutreach.org, www.chuinooutreach.org, www.cuinooutreach.org, www.chjinooutreach.org, www.cjinooutreach.org, www.chinooutreach.org, www.cinooutreach.org, www.chbinooutreach.org, www.cbinooutreach.org, www.chginooutreach.org, www.cginooutreach.org, www.chnooutreach.org, www.chirnooutreach.org, www.chrnooutreach.org, www.chifnooutreach.org, www.chfnooutreach.org, www.chivnooutreach.org, www.chvnooutreach.org, www.chiknooutreach.org, www.chknooutreach.org, www.chi,nooutreach.org, www.ch,nooutreach.org, www.chibnooutreach.org, www.chbnooutreach.org, www.chignooutreach.org, www.chgnooutreach.org, www.chitnooutreach.org, www.chtnooutreach.org, www.chiynooutreach.org, www.chynooutreach.org, www.chiunooutreach.org, www.chunooutreach.org, www.chijnooutreach.org, www.chjnooutreach.org, www.chimnooutreach.org, www.chmnooutreach.org, www.chinnooutreach.org, www.chnnooutreach.org, www.chiooutreach.org, www.chinnooutreach.org, www.chinooutreach.org, www.chinhooutreach.org, www.chihooutreach.org, www.chinjooutreach.org, www.chijooutreach.org, www.chinkooutreach.org, www.chikooutreach.org, www.chinlooutreach.org, www.chilooutreach.org, www.chin ooutreach.org, www.chi ooutreach.org, www.chinoutreach.org, www.chinoboutreach.org, www.chinboutreach.org, www.chinohoutreach.org, www.chinhoutreach.org, www.chinogoutreach.org, www.chingoutreach.org, www.chinojoutreach.org, www.chinjoutreach.org, www.chinomoutreach.org, www.chinmoutreach.org, www.chino outreach.org, www.chin outreach.org, www.chinovoutreach.org, www.chinvoutreach.org, www.chinoutreach.org, www.chinoobutreach.org, www.chinobutreach.org, www.chinoohutreach.org, www.chinohutreach.org, www.chinoogutreach.org, www.chinogutreach.org, www.chinoojutreach.org, www.chinojutreach.org, www.chinoomutreach.org, www.chinomutreach.org, www.chinoo utreach.org, www.chino utreach.org, www.chinoovutreach.org, www.chinovutreach.org, www.chinootreach.org, www.chinoouwtreach.org, www.chinoowtreach.org, www.chinoouetreach.org, www.chinooetreach.org, www.chinooustreach.org, www.chinoostreach.org, www.chinoouatreach.org, www.chinooatreach.org, www.chinooureach.org, www.chinooutqreach.org, www.chinoouqreach.org, www.chinooutareach.org, www.chinoouareach.org, www.chinoout reach.org, www.chinoou reach.org, www.chinooutwreach.org, www.chinoouwreach.org, www.chinooutereach.org, www.chinoouereach.org, www.chinooutzreach.org, www.chinoouzreach.org, www.chinooutxreach.org, www.chinoouxreach.org, www.chinooutcreach.org, www.chinooucreach.org, www.chinoouteach.org, www.chinooutrieach.org, www.chinooutieach.org, www.chinooutroeach.org, www.chinooutoeach.org, www.chinooutrleach.org, www.chinooutleach.org, www.chinooutrleach.org, www.chinooutleach.org, www.chinooutr.each.org, www.chinoout.each.org, www.chinooutrach.org, www.chinooutrexach.org, www.chinooutrxach.org, www.chinooutresach.org, www.chinooutrsach.org, www.chinooutrewach.org, www.chinooutrwach.org, www.chinooutrerach.org, www.chinooutrrach.org, www.chinooutrefach.org, www.chinooutrfach.org, www.chinooutrevach.org, www.chinooutrvach.org, www.chinooutrecach.org, www.chinooutrcach.org, www.chinooutreqach.org, www.chinooutrqach.org, www.chinooutreaach.org, www.chinooutraach.org, www.chinooutreyach.org, www.chinooutryach.org,

Other websites we recently analyzed

  1. bikerallyonthesquare.info
    Scottsdale (United States) - 184.168.221.49
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  2. Sorob IT Ltd. – Internet Service Provider
    Dhaka (Bangladesh) - 103.21.41.2
    Server software:
    Technology: Carousel, CSS, Fancybox, Html, Html5, Javascript, jQuery, Php, Pingback, SVG, Wordpress
    Number of Javascript: 8
    Number of meta tags: 3
  3. FDP-Kriftel
    Portal FDP Main-Taunus
    Germany - 84.200.16.170
    Server software: Microsoft-IIS/8.5
    Technology: CSS, Font Awesome, Google Font API, Html, Javascript
    Number of Javascript: 13
    Number of meta tags: 12
  4. ppt之窗-老马玩转ppt精品教程
    ppt之窗,老马,玩转ppt,精品教程,9d新媒,九弟新媒,9d设计
    Hangzhou (China) - 43.229.111.69
    Server software: nginx
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 8
    Number of meta tags: 6
  5. 镒松化工(昆山)有限公司
    镒松化工(昆山)有限公司
    Shanghai (China) - 118.193.130.17
    Server software: IIS
    Technology: CSS, Html, Javascript, Swf Object
    Number of Javascript: 6
    Number of meta tags: 3
  6. Прокладка маршрутов и рассчет растояний между городами стран бывшего СССР
    Прокладка маршрутов и рассчет растояний между городами стран бывшего СССР
    Yoshkar-ola (Russian Federation) - 188.187.188.153
    Server software: nginx
    Technology: Google Adsense, CSS, Google Font API, Html, Html5, Javascript, jQuery, jQuery UI, Yandex.Metrika, LiveInternet counter
    Number of Javascript: 5
    Number of meta tags: 3
  7. Tobin Keller - Home
    San Francisco (United States) - 199.34.228.100
    Server software: Apache
    Technology: CSS, Html, Html5, Iframe, Javascript, Php, SVG, Google Analytics, Quantcast Measurement, Webly
    Number of Javascript: 4
    Number of meta tags: 1
  8. Clever Einkaufen - Willkommen
    Germany - 148.251.77.143
    G Analytics ID: UA-10820673-2
    Server software: Apache
    Technology: CSS, Html, Iframe, Javascript, Php, Google Analytics, Facebook Like button, Facebook Box
    Number of Javascript: 2
    Number of meta tags: 7
  9. lissahi.com
    Italy - 81.88.57.68
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  10. پایگاه فرهنگی مذهبی ابو شهر
    پایگاه فرهنگی مذهبی ابوشهر با موضوعات مختلف فرهنگی مذهبی برای استفاده عموم خصوصا هم استانی های بوشهری ایجاد شده است,پایگاه فرهنگی مذهبی ابو شهر
    Iran, Islamic Republic of - 79.127.127.68
    Server software: LiteSpeed
    Technology: CSS, Html, Iframe, Javascript, Php, SuperFish
    Number of Javascript: 18
    Number of meta tags: 4

Check Other Websites